PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DL_918A8F357.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 291aa    MW: 33465.7 Da    PI: 6.965
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DL_918A8F357.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding538.2e-173177148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g WT+eEd +lv++v+q+G g W+  a++++  R +kqc++rw+++l
  Traes_1DL_918A8F357.1 31 KGQWTPEEDRKLVKLVEQFGLGKWSQMAQMLP-VRVGKQCRERWHNHL 77
                           799*****************************.9************97 PP

2Myb_DNA-binding50.83.8e-1683125145
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            ++ W++eEd  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
  Traes_1DL_918A8F357.1  83 KDTWSEEEDMVLIQTHKEVGNK-WAEIAKRLP-GRTENSIKNHWN 125
                            679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.4822681IPR017930Myb domain
SuperFamilySSF466891.6E-3128124IPR009057Homeodomain-like
SMARTSM007172.5E-153079IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-283284IPR009057Homeodomain-like
PfamPF139212.0E-193492No hitNo description
CDDcd001673.25E-143477No hitNo description
SMARTSM007172.5E-1582130IPR001005SANT/Myb domain
PROSITE profilePS5129420.28782132IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.2E-2285130IPR009057Homeodomain-like
CDDcd001677.60E-1285128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGSYKTYEMS GRFIPRRKAS SKAVKKTNVV KGQWTPEEDR KLVKLVEQFG LGKWSQMAQM  60
LPVRVGKQCR ERWHNHLRPN IKKDTWSEEE DMVLIQTHKE VGNKWAEIAK RLPGRTENSI  120
KNHWNATKRR QFARRQTGTK AKNPKSGTLL QNYIKSLGIG SSKVIAPLDP KEPPLSAFSP  180
APPTQNRAHM NDNWPESNPS NIMVTQGIFS TDDRQIHSCE EILVPTSDDF SVDMFDGLFN  240
AEEVQYQAYN IDDDVDMDYI INHIDYSIKN DHEIDMDMTW DDDALVNIES G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-43291322105MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-43291322105C-Myb DNA-Binding Domain
1msf_C2e-43291322105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010228004.11e-150PREDICTED: transcription factor MYB46-like
TrEMBLW5AGS40.0W5AGS4_WHEAT; Uncharacterized protein
STRINGBGIOSGA022369-PA1e-130(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-69myb domain protein 98
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]